PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000230141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 270aa    MW: 30453.6 Da    PI: 5.0765
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000230141genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l   ++++G g+W++ ++  g+ R++k+c++rw +yl
    MDP0000230141 14 KGPWTSEEDQILTSFIHKYGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.94.2e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
    MDP0000230141  67 RGNFTREEEEAIIKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.172961IPR017930Myb domain
SuperFamilySSF466898.07E-3110108IPR009057Homeodomain-like
SMARTSM007179.2E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001671.03E-101661No hitNo description
PROSITE profilePS5129426.49362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2765116IPR009057Homeodomain-like
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001672.30E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTSE EDQILTSFIH KYGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEEAIIK LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKDHT  120
TTTSSTTSTR SSSNSTSNVX SQFVDEPENL NYPQPSSSDV SSSVTKVSAA LSTDQDTIVV  180
KGENMELSET FPDIDDDSFW SEALSTDNSS VPLQFPKASN DEPISEFPIT KNDSEEFGFS  240
FGLNMDDGME FWYDLFIRTG HGGTPELPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744710.0DQ074471.1 Malus x domestica MYB23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280969.10.0uncharacterized protein LOC103420593
TrEMBLQ2LME10.0Q2LME1_MALDO; MYB23
STRINGPOPTR_0008s16660.12e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-80myb domain protein 14
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]